Nothing you type is stored

Is it a known spammer?

Check an email address, phone number or domain against 7,539,813 entries in community spam and scam databases. Nothing is stored.

7,539,813entries in the databases
Listed as spam / abuse
“kayipesyaburosuxxxxxxxzzzzzzzz.arceliktelvekampanyasigeldikacirmayinkampanya.arzumokka.online” matches 1 entry(ies).
WhatCategorySourceConfidenceSince
domain kayipesyaburosuxxxxxxxzzzzzzzz.arceliktelvekampanyasigeldikacirmayinkampanya.arzumokka.onlinePhishingUSOM (Turkish Cyber Security Directorate)80%2026-08-10

Full threat report for this domain →

Network abuse / attacks · 2,619,741 Spam · 1,371,381 Phishing · 1,343,255 Scam · 535,283 Malware distribution · 446,427 Crypto phishing · 356,506 Illegal gambling · 339,559 Disposable email domain · 222,565 Robocalls / unwanted calls · 104,610 Reported stolen · 66,225 Botnet control server · 53,968 Product safety recall · 41,596 Government-sanctioned entity · 24,153 Crypto scam / drainer · 14,401 Consumer complaints · 143
Recently reported phone numbers Browse all →

Numbers with consumer complaints in the US FTC Do Not Call registry; the count is complaints on file.

Recently flagged domains Browse all →

Active malware and crypto-phishing domains from URLhaus, ThreatFox (abuse.ch, CC0) and the MetaMask blocklist. Do not visit them.

Own a website? Astrina can screen the emails and phones that come through your lead forms against this same list automatically. See how →

What this page answers