Nothing you type is stored
Is it a known spammer?
Check an email address, phone number or domain against 7,539,813 entries in community spam and scam databases. Nothing is stored.
7,539,813entries in the databases
Listed as spam / abuse
“kayipesyaburosuxxxxxxxzzzzzzzz.arceliktelvekampanyasigeldikacirmayinkampanya.arzumokka.online” matches 1 entry(ies).
| What | Category | Source | Confidence | Since |
|---|---|---|---|---|
| domain kayipesyaburosuxxxxxxxzzzzzzzz.arceliktelvekampanyasigeldikacirmayinkampanya.arzumokka.online | Phishing | USOM (Turkish Cyber Security Directorate) | 80% | 2026-08-10 |
Network abuse / attacks · 2,619,741 Spam · 1,371,381 Phishing · 1,343,255 Scam · 535,283 Malware distribution · 446,427 Crypto phishing · 356,506 Illegal gambling · 339,559 Disposable email domain · 222,565 Robocalls / unwanted calls · 104,610 Reported stolen · 66,225 Botnet control server · 53,968 Product safety recall · 41,596 Government-sanctioned entity · 24,153 Crypto scam / drainer · 14,401 Consumer complaints · 143
Recently reported phone numbers Browse all →
+1 978 261 067 9 · 1 +1 918 451 324 5 · 2 +1 318 704 428 0 · 1 +1 318 705 691 3 · 1 +1 318 612 024 1 · 1 +1 801 557 516 3 · 1 +1 631 412 851 4 · 1 +1 714 340 450 9 · 4
Numbers with consumer complaints in the US FTC Do Not Call registry; the count is complaints on file.
Recently flagged domains Browse all →
namuvpn.com images2.imgbox.com lifeisabouthavingfun448.duckdns.org workerstats.net farschid.de cdn.pixelbin.io r-tt.com hcsnet.com.br
Active malware and crypto-phishing domains from URLhaus, ThreatFox (abuse.ch, CC0) and the MetaMask blocklist. Do not visit them.
Own a website? Astrina can screen the emails and phones that come through your lead forms against this same list automatically. See how →
What this page answers
- check domain blacklist
- is this email spam
- phone spam database
- blacklist lookup free
- spam and blacklist check online
- spam and blacklist check free
- spam and blacklist check tool
- online spam and blacklist check
- spam and blacklist check without registration
- spam and blacklist check in browser
- free spam and blacklist check tool
- spam and blacklist check checker
- how to spam and blacklist check
- spam and blacklist check online free
- spam and blacklist check for a website
- spam and blacklist check quick check
- best spam and blacklist check tool
- spam and blacklist check no signup