← Spam & blacklist check · Flagged domains
Is 101tentkampanyasialimadresinegir.cfd safe?
Flagged as dangerous Phishing
This domain appears in public security threat feeds. Do not enter passwords, download files or send money to it.
Listings
| Category | Source | Details | Confidence | Since |
|---|---|---|---|---|
| Phishing | USOM (Turkish Cyber Security Directorate) | On the USOM (Turkey national CERT) malicious-site list | 80% | 2026-08-10 |
Threat details
First seen
—
Last seen
2026-09-25
So far the network has warned earlier than the threat feeds in 0 case(s).
Report data comes from public threat feeds (URLhaus, ThreatFox and Feodo Tracker by abuse.ch — CC0; MetaMask eth-phishing-detect; Phishing.Database) and is shown with attribution. Listings change as the sources update.
What this page answers
- is 101tentkampanyasialimadresinegir.cfd safe
- 101tentkampanyasialimadresinegir.cfd virus or not
- 101tentkampanyasialimadresinegir.cfd phishing check
- 101tentkampanyasialimadresinegir.cfd blacklist check
- 101tentkampanyasialimadresinegir.cfd reviews
- 101tentkampanyasialimadresinegir.cfd reviews and ratings
- is 101tentkampanyasialimadresinegir.cfd legit
- is 101tentkampanyasialimadresinegir.cfd a scam
- 101tentkampanyasialimadresinegir.cfd real user reviews
- 101tentkampanyasialimadresinegir.cfd rating
- 101tentkampanyasialimadresinegir.cfd complaints
- what people say about 101tentkampanyasialimadresinegir.cfd
- 101tentkampanyasialimadresinegir.cfd domain reviews
- 101tentkampanyasialimadresinegir.cfd pros and cons
- 101tentkampanyasialimadresinegir.cfd experience
- should I trust 101tentkampanyasialimadresinegir.cfd
- 101tentkampanyasialimadresinegir.cfd feedback
- 101tentkampanyasialimadresinegir.cfd review 2026
- 101tentkampanyasialimadresinegir.cfd check
- 101tentkampanyasialimadresinegir.cfd safety check