← Spam & blacklist check · Flagged domains

Is 100yilkampanyalllllarfirsatlllariii.com safe?

Flagged as dangerous Phishing
This domain appears in public security threat feeds. Do not enter passwords, download files or send money to it.
Listings
CategorySourceDetailsConfidenceSince
PhishingUSOM (Turkish Cyber Security Directorate)On the USOM (Turkey national CERT) malicious-site list80%2026-08-10
Threat details
First seen
—
Last seen
2026-09-26

So far the network has warned earlier than the threat feeds in 0 case(s).

Report data comes from public threat feeds (URLhaus, ThreatFox and Feodo Tracker by abuse.ch — CC0; MetaMask eth-phishing-detect; Phishing.Database) and is shown with attribution. Listings change as the sources update.

What this page answers